Lineage for d1jyye3 (1jyy E:3-219)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777099Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 1777100Protein beta-Galactosidase [49804] (2 species)
  7. 1777108Species Escherichia coli [TaxId:562] [49805] (42 PDB entries)
    Uniprot P00722
  8. 1777305Domain d1jyye3: 1jyy E:3-219 [67572]
    Other proteins in same PDB: d1jyya1, d1jyya2, d1jyya4, d1jyya5, d1jyyb1, d1jyyb2, d1jyyb4, d1jyyb5, d1jyyc1, d1jyyc2, d1jyyc4, d1jyyc5, d1jyyd1, d1jyyd2, d1jyyd4, d1jyyd5, d1jyye1, d1jyye2, d1jyye4, d1jyye5, d1jyyf1, d1jyyf2, d1jyyf4, d1jyyf5, d1jyyg1, d1jyyg2, d1jyyg4, d1jyyg5, d1jyyh1, d1jyyh2, d1jyyh4, d1jyyh5
    complexed with 2fl, mg, na
    complexed with 2fl, mg, na

Details for d1jyye3

PDB Entry: 1jyy (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with 2-f-lactose. chains a-h, see remark 400.
PDB Compounds: (E:) beta-galactosidase

SCOPe Domain Sequences for d1jyye3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyye3 b.18.1.5 (E:3-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1jyye3:

Click to download the PDB-style file with coordinates for d1jyye3.
(The format of our PDB-style files is described here.)

Timeline for d1jyye3: