Lineage for d1jyye1 (1jyy E:220-333)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372435Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2372436Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2372450Species Escherichia coli [TaxId:562] [49306] (45 PDB entries)
    Uniprot P00722
  8. 2372843Domain d1jyye1: 1jyy E:220-333 [67570]
    Other proteins in same PDB: d1jyya3, d1jyya4, d1jyya5, d1jyyb3, d1jyyb4, d1jyyb5, d1jyyc3, d1jyyc4, d1jyyc5, d1jyyd3, d1jyyd4, d1jyyd5, d1jyye3, d1jyye4, d1jyye5, d1jyyf3, d1jyyf4, d1jyyf5, d1jyyg3, d1jyyg4, d1jyyg5, d1jyyh3, d1jyyh4, d1jyyh5
    complexed with 2fl, mg, na
    complexed with 2fl, mg, na

Details for d1jyye1

PDB Entry: 1jyy (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with 2-f-lactose. chains a-h, see remark 400.
PDB Compounds: (E:) beta-galactosidase

SCOPe Domain Sequences for d1jyye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyye1 b.1.4.1 (E:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d1jyye1:

Click to download the PDB-style file with coordinates for d1jyye1.
(The format of our PDB-style files is described here.)

Timeline for d1jyye1: