Lineage for d1jyyc2 (1jyy C:626-730)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105419Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 105420Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 protein domains)
  6. 105421Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 105422Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)
  8. 105636Domain d1jyyc2: 1jyy C:626-730 [67561]
    Other proteins in same PDB: d1jyya3, d1jyya4, d1jyya5, d1jyyb3, d1jyyb4, d1jyyb5, d1jyyc3, d1jyyc4, d1jyyc5, d1jyyd3, d1jyyd4, d1jyyd5, d1jyye3, d1jyye4, d1jyye5, d1jyyf3, d1jyyf4, d1jyyf5, d1jyyg3, d1jyyg4, d1jyyg5, d1jyyh3, d1jyyh4, d1jyyh5

Details for d1jyyc2

PDB Entry: 1jyy (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with 2-f-lactose. chains a-h, see remark 400.

SCOP Domain Sequences for d1jyyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyyc2 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOP Domain Coordinates for d1jyyc2:

Click to download the PDB-style file with coordinates for d1jyyc2.
(The format of our PDB-style files is described here.)

Timeline for d1jyyc2: