Lineage for d1jyxc5 (1jyx C:334-625)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173428Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 173433Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 173434Species Escherichia coli [TaxId:562] [51511] (23 PDB entries)
  8. 173461Domain d1jyxc5: 1jyx C:334-625 [67544]
    Other proteins in same PDB: d1jyxa1, d1jyxa2, d1jyxa3, d1jyxa4, d1jyxb1, d1jyxb2, d1jyxb3, d1jyxb4, d1jyxc1, d1jyxc2, d1jyxc3, d1jyxc4, d1jyxd1, d1jyxd2, d1jyxd3, d1jyxd4

Details for d1jyxc5

PDB Entry: 1jyx (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with iptg

SCOP Domain Sequences for d1jyxc5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyxc5 c.1.8.3 (C:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1jyxc5:

Click to download the PDB-style file with coordinates for d1jyxc5.
(The format of our PDB-style files is described here.)

Timeline for d1jyxc5: