Lineage for d1jyxc4 (1jyx C:731-1023)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391262Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2391263Protein beta-Galactosidase, domain 5 [49996] (3 species)
  7. 2391271Species Escherichia coli [TaxId:562] [49997] (45 PDB entries)
    Uniprot P00722
  8. 2391298Domain d1jyxc4: 1jyx C:731-1023 [67543]
    Other proteins in same PDB: d1jyxa1, d1jyxa2, d1jyxa3, d1jyxa5, d1jyxb1, d1jyxb2, d1jyxb3, d1jyxb5, d1jyxc1, d1jyxc2, d1jyxc3, d1jyxc5, d1jyxd1, d1jyxd2, d1jyxd3, d1jyxd5
    complexed with dms, ipt, mg, na

Details for d1jyxc4

PDB Entry: 1jyx (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with iptg
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1jyxc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyxc4 b.30.5.1 (C:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d1jyxc4:

Click to download the PDB-style file with coordinates for d1jyxc4.
(The format of our PDB-style files is described here.)

Timeline for d1jyxc4: