Lineage for d1jyxc1 (1jyx C:220-333)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372435Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2372436Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2372450Species Escherichia coli [TaxId:562] [49306] (45 PDB entries)
    Uniprot P00722
  8. 2372503Domain d1jyxc1: 1jyx C:220-333 [67540]
    Other proteins in same PDB: d1jyxa3, d1jyxa4, d1jyxa5, d1jyxb3, d1jyxb4, d1jyxb5, d1jyxc3, d1jyxc4, d1jyxc5, d1jyxd3, d1jyxd4, d1jyxd5
    complexed with dms, ipt, mg, na

Details for d1jyxc1

PDB Entry: 1jyx (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with iptg
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1jyxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyxc1 b.1.4.1 (C:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d1jyxc1:

Click to download the PDB-style file with coordinates for d1jyxc1.
(The format of our PDB-style files is described here.)

Timeline for d1jyxc1: