![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein beta-Galactosidase, domain 3 [51510] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [51511] (46 PDB entries) Uniprot P00722 |
![]() | Domain d1jyxb5: 1jyx B:334-625 [67539] Other proteins in same PDB: d1jyxa1, d1jyxa2, d1jyxa3, d1jyxa4, d1jyxb1, d1jyxb2, d1jyxb3, d1jyxb4, d1jyxc1, d1jyxc2, d1jyxc3, d1jyxc4, d1jyxd1, d1jyxd2, d1jyxd3, d1jyxd4 complexed with dms, ipt, mg, na |
PDB Entry: 1jyx (more details), 1.75 Å
SCOPe Domain Sequences for d1jyxb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyxb5 c.1.8.3 (B:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d1jyxb5:
![]() Domains from same chain: (mouse over for more information) d1jyxb1, d1jyxb2, d1jyxb3, d1jyxb4 |