![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
![]() | Protein beta-Galactosidase [49804] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [49805] (46 PDB entries) Uniprot P00722 |
![]() | Domain d1jyxb3: 1jyx B:13-219 [67537] Other proteins in same PDB: d1jyxa1, d1jyxa2, d1jyxa4, d1jyxa5, d1jyxb1, d1jyxb2, d1jyxb4, d1jyxb5, d1jyxc1, d1jyxc2, d1jyxc4, d1jyxc5, d1jyxd1, d1jyxd2, d1jyxd4, d1jyxd5 complexed with dms, ipt, mg, na |
PDB Entry: 1jyx (more details), 1.75 Å
SCOPe Domain Sequences for d1jyxb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyxb3 b.18.1.5 (B:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d1jyxb3:
![]() Domains from same chain: (mouse over for more information) d1jyxb1, d1jyxb2, d1jyxb4, d1jyxb5 |