Lineage for d1jyxb2 (1jyx B:626-730)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 290722Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 290723Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 290724Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 290725Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)
  8. 290777Domain d1jyxb2: 1jyx B:626-730 [67536]
    Other proteins in same PDB: d1jyxa3, d1jyxa4, d1jyxa5, d1jyxb3, d1jyxb4, d1jyxb5, d1jyxc3, d1jyxc4, d1jyxc5, d1jyxd3, d1jyxd4, d1jyxd5

Details for d1jyxb2

PDB Entry: 1jyx (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with iptg
PDB Compounds: (B:)

SCOP Domain Sequences for d1jyxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyxb2 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOP Domain Coordinates for d1jyxb2:

Click to download the PDB-style file with coordinates for d1jyxb2.
(The format of our PDB-style files is described here.)

Timeline for d1jyxb2: