Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) |
Species Escherichia coli [TaxId:562] [49306] (23 PDB entries) |
Domain d1jyxb2: 1jyx B:626-730 [67536] Other proteins in same PDB: d1jyxa3, d1jyxa4, d1jyxa5, d1jyxb3, d1jyxb4, d1jyxb5, d1jyxc3, d1jyxc4, d1jyxc5, d1jyxd3, d1jyxd4, d1jyxd5 |
PDB Entry: 1jyx (more details), 1.75 Å
SCOP Domain Sequences for d1jyxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyxb2 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d1jyxb2:
View in 3D Domains from same chain: (mouse over for more information) d1jyxb1, d1jyxb3, d1jyxb4, d1jyxb5 |