Lineage for d1jyxa5 (1jyx A:334-625)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474407Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 474445Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 474446Species Escherichia coli [TaxId:562] [51511] (25 PDB entries)
  8. 474463Domain d1jyxa5: 1jyx A:334-625 [67534]
    Other proteins in same PDB: d1jyxa1, d1jyxa2, d1jyxa3, d1jyxa4, d1jyxb1, d1jyxb2, d1jyxb3, d1jyxb4, d1jyxc1, d1jyxc2, d1jyxc3, d1jyxc4, d1jyxd1, d1jyxd2, d1jyxd3, d1jyxd4

Details for d1jyxa5

PDB Entry: 1jyx (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with iptg

SCOP Domain Sequences for d1jyxa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyxa5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1jyxa5:

Click to download the PDB-style file with coordinates for d1jyxa5.
(The format of our PDB-style files is described here.)

Timeline for d1jyxa5: