Lineage for d1jywd2 (1jyw D:626-730)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) 
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) 
Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) Species Escherichia coli [TaxId:562] [49306] (45 PDB entries)
Uniprot P00722
Domain d1jywd2: 1jyw D:626-730 [67526]
Other proteins in same PDB: d1jywa3, d1jywa4, d1jywa5, d1jywb3, d1jywb4, d1jywb5, d1jywc3, d1jywc4, d1jywc5, d1jywd3, d1jywd4, d1jywd5
complexed with 147, dms, mg, na
Details for d1jywd2
PDB Entry: 1jyw (more details), 1.55 Å
PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with pnpg
PDB Compounds: (D:) beta-galactosidaseSCOPe Domain Sequences for d1jywd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jywd2 b.1.4.1 (D:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
SCOPe Domain Coordinates for d1jywd2:
Click to download the PDB-style file with coordinates for d1jywd2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jywd2:
- d1jywd2 first appeared in SCOP 1.59
- d1jywd2 appears in SCOPe 2.06
- d1jywd2 appears in the current release, SCOPe 2.08
 View in 3DDomains from same chain: (mouse over for more information) d1jywd1, d1jywd3, d1jywd4, d1jywd5 |
