![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
![]() | Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [49306] (45 PDB entries) Uniprot P00722 |
![]() | Domain d1jywd1: 1jyw D:220-333 [67525] Other proteins in same PDB: d1jywa3, d1jywa4, d1jywa5, d1jywb3, d1jywb4, d1jywb5, d1jywc3, d1jywc4, d1jywc5, d1jywd3, d1jywd4, d1jywd5 complexed with 147, dms, mg, na |
PDB Entry: 1jyw (more details), 1.55 Å
SCOPe Domain Sequences for d1jywd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jywd1 b.1.4.1 (D:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d1jywd1:
![]() Domains from same chain: (mouse over for more information) d1jywd2, d1jywd3, d1jywd4, d1jywd5 |