Lineage for d1jywc5 (1jyw C:334-625)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439329Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2439337Species Escherichia coli [TaxId:562] [51511] (45 PDB entries)
    Uniprot P00722
  8. 2439344Domain d1jywc5: 1jyw C:334-625 [67524]
    Other proteins in same PDB: d1jywa1, d1jywa2, d1jywa3, d1jywa4, d1jywb1, d1jywb2, d1jywb3, d1jywb4, d1jywc1, d1jywc2, d1jywc3, d1jywc4, d1jywd1, d1jywd2, d1jywd3, d1jywd4
    complexed with 147, dms, mg, na

Details for d1jywc5

PDB Entry: 1jyw (more details), 1.55 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with pnpg
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1jywc5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jywc5 c.1.8.3 (C:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilcqyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d1jywc5:

Click to download the PDB-style file with coordinates for d1jywc5.
(The format of our PDB-style files is described here.)

Timeline for d1jywc5: