Lineage for d1jywc5 (1jyw C:334-625)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173428Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 173433Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 173434Species Escherichia coli [TaxId:562] [51511] (23 PDB entries)
  8. 173445Domain d1jywc5: 1jyw C:334-625 [67524]
    Other proteins in same PDB: d1jywa1, d1jywa2, d1jywa3, d1jywa4, d1jywb1, d1jywb2, d1jywb3, d1jywb4, d1jywc1, d1jywc2, d1jywc3, d1jywc4, d1jywd1, d1jywd2, d1jywd3, d1jywd4

Details for d1jywc5

PDB Entry: 1jyw (more details), 1.55 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with pnpg

SCOP Domain Sequences for d1jywc5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jywc5 c.1.8.3 (C:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilcqyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1jywc5:

Click to download the PDB-style file with coordinates for d1jywc5.
(The format of our PDB-style files is described here.)

Timeline for d1jywc5: