Lineage for d1jywc4 (1jyw C:731-1023)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109071Fold b.30: Supersandwich [49993] (4 superfamilies)
  4. 109072Superfamily b.30.1: beta-Galactosidase, domain 5 [49994] (1 family) (S)
  5. 109073Family b.30.1.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 109074Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 109075Species Escherichia coli [TaxId:562] [49997] (23 PDB entries)
  8. 109086Domain d1jywc4: 1jyw C:731-1023 [67523]
    Other proteins in same PDB: d1jywa1, d1jywa2, d1jywa3, d1jywa5, d1jywb1, d1jywb2, d1jywb3, d1jywb5, d1jywc1, d1jywc2, d1jywc3, d1jywc5, d1jywd1, d1jywd2, d1jywd3, d1jywd5

Details for d1jywc4

PDB Entry: 1jyw (more details), 1.55 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with pnpg

SCOP Domain Sequences for d1jywc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jywc4 b.30.1.1 (C:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1jywc4:

Click to download the PDB-style file with coordinates for d1jywc4.
(The format of our PDB-style files is described here.)

Timeline for d1jywc4: