Lineage for d1jywc2 (1jyw C:626-730)
- Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) 
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) Species Escherichia coli [TaxId:562] [49306] (23 PDB entries) 
Domain d1jywc2: 1jyw C:626-730 [67521]
Other proteins in same PDB: d1jywa3, d1jywa4, d1jywa5, d1jywb3, d1jywb4, d1jywb5, d1jywc3, d1jywc4, d1jywc5, d1jywd3, d1jywd4, d1jywd5
Details for d1jywc2
PDB Entry: 1jyw (more details), 1.55 Å
PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with pnpg
SCOP Domain Sequences for d1jywc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jywc2 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
SCOP Domain Coordinates for d1jywc2:
Click to download the PDB-style file with coordinates for d1jywc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jywc2:
- d1jywc2 first appeared in SCOP 1.59
- d1jywc2 appears in SCOP 1.63
- d1jywc2 appears in SCOP 1.67
- d1jywc2 appears in the current release, SCOPe 2.08
 View in 3DDomains from same chain: (mouse over for more information) d1jywc1, d1jywc3, d1jywc4, d1jywc5 |
