Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species) |
Species Escherichia coli [TaxId:562] [49306] (25 PDB entries) Uniprot P00722 |
Domain d1jywc1: 1jyw C:220-333 [67520] Other proteins in same PDB: d1jywa3, d1jywa4, d1jywa5, d1jywb3, d1jywb4, d1jywb5, d1jywc3, d1jywc4, d1jywc5, d1jywd3, d1jywd4, d1jywd5 complexed with 147, dms, mg, na |
PDB Entry: 1jyw (more details), 1.55 Å
SCOPe Domain Sequences for d1jywc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jywc1 b.1.4.1 (C:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d1jywc1:
View in 3D Domains from same chain: (mouse over for more information) d1jywc2, d1jywc3, d1jywc4, d1jywc5 |