Lineage for d1jywb3 (1jyw B:13-219)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163940Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 163941Superfamily b.18.1: Galactose-binding domain-like [49785] (15 families) (S)
  5. 163983Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)
  6. 163984Protein beta-Galactosidase [49804] (1 species)
  7. 163985Species Escherichia coli [TaxId:562] [49805] (23 PDB entries)
  8. 163995Domain d1jywb3: 1jyw B:13-219 [67517]
    Other proteins in same PDB: d1jywa1, d1jywa2, d1jywa4, d1jywa5, d1jywb1, d1jywb2, d1jywb4, d1jywb5, d1jywc1, d1jywc2, d1jywc4, d1jywc5, d1jywd1, d1jywd2, d1jywd4, d1jywd5

Details for d1jywb3

PDB Entry: 1jyw (more details), 1.55 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with pnpg

SCOP Domain Sequences for d1jywb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jywb3 b.18.1.5 (B:13-219) beta-Galactosidase {Escherichia coli}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOP Domain Coordinates for d1jywb3:

Click to download the PDB-style file with coordinates for d1jywb3.
(The format of our PDB-style files is described here.)

Timeline for d1jywb3: