![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
![]() | Protein beta-Galactosidase [49804] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [49805] (45 PDB entries) Uniprot P00722 |
![]() | Domain d1jywa3: 1jyw A:13-219 [67512] Other proteins in same PDB: d1jywa1, d1jywa2, d1jywa4, d1jywa5, d1jywb1, d1jywb2, d1jywb4, d1jywb5, d1jywc1, d1jywc2, d1jywc4, d1jywc5, d1jywd1, d1jywd2, d1jywd4, d1jywd5 complexed with 147, dms, mg, na |
PDB Entry: 1jyw (more details), 1.55 Å
SCOPe Domain Sequences for d1jywa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jywa3 b.18.1.5 (A:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d1jywa3:
![]() Domains from same chain: (mouse over for more information) d1jywa1, d1jywa2, d1jywa4, d1jywa5 |