Lineage for d1jywa2 (1jyw A:626-730)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 290722Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 290723Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 290724Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 290725Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)
  8. 290743Domain d1jywa2: 1jyw A:626-730 [67511]
    Other proteins in same PDB: d1jywa3, d1jywa4, d1jywa5, d1jywb3, d1jywb4, d1jywb5, d1jywc3, d1jywc4, d1jywc5, d1jywd3, d1jywd4, d1jywd5

Details for d1jywa2

PDB Entry: 1jyw (more details), 1.55 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with pnpg
PDB Compounds: (A:)

SCOP Domain Sequences for d1jywa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jywa2 b.1.4.1 (A:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOP Domain Coordinates for d1jywa2:

Click to download the PDB-style file with coordinates for d1jywa2.
(The format of our PDB-style files is described here.)

Timeline for d1jywa2: