Lineage for d1jyvd4 (1jyv D:731-1023)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165116Fold b.30: Supersandwich [49993] (3 superfamilies)
  4. 165166Superfamily b.30.5: Galactose mutarotase-like [74650] (4 families) (S)
  5. 165167Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 165168Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 165169Species Escherichia coli [TaxId:562] [49997] (23 PDB entries)
  8. 165201Domain d1jyvd4: 1jyv D:731-1023 [67508]
    Other proteins in same PDB: d1jyva1, d1jyva2, d1jyva3, d1jyva5, d1jyvb1, d1jyvb2, d1jyvb3, d1jyvb5, d1jyvc1, d1jyvc2, d1jyvc3, d1jyvc5, d1jyvd1, d1jyvd2, d1jyvd3, d1jyvd5

Details for d1jyvd4

PDB Entry: 1jyv (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with onpg

SCOP Domain Sequences for d1jyvd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyvd4 b.30.5.1 (D:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1jyvd4:

Click to download the PDB-style file with coordinates for d1jyvd4.
(The format of our PDB-style files is described here.)

Timeline for d1jyvd4: