Lineage for d1jyvd1 (1jyv D:220-333)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) 
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) Species Escherichia coli [TaxId:562] [49306] (23 PDB entries) 
Domain d1jyvd1: 1jyv D:220-333 [67505]
Other proteins in same PDB: d1jyva3, d1jyva4, d1jyva5, d1jyvb3, d1jyvb4, d1jyvb5, d1jyvc3, d1jyvc4, d1jyvc5, d1jyvd3, d1jyvd4, d1jyvd5
Details for d1jyvd1
PDB Entry: 1jyv (more details), 1.75 Å
PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with onpg
SCOP Domain Sequences for d1jyvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyvd1 b.1.4.1 (D:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
SCOP Domain Coordinates for d1jyvd1:
Click to download the PDB-style file with coordinates for d1jyvd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jyvd1:
- d1jyvd1 first appeared in SCOP 1.59
- d1jyvd1 appears in SCOP 1.65
- d1jyvd1 appears in SCOP 1.69
- d1jyvd1 appears in the current release, SCOPe 2.08
 View in 3DDomains from same chain: (mouse over for more information) d1jyvd2, d1jyvd3, d1jyvd4, d1jyvd5 |
