Class b: All beta proteins [48724] (174 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein beta-Galactosidase [49804] (2 species) |
Species Escherichia coli [TaxId:562] [49805] (25 PDB entries) Uniprot P00722 |
Domain d1jyvc3: 1jyv C:13-219 [67502] Other proteins in same PDB: d1jyva1, d1jyva2, d1jyva4, d1jyva5, d1jyvb1, d1jyvb2, d1jyvb4, d1jyvb5, d1jyvc1, d1jyvc2, d1jyvc4, d1jyvc5, d1jyvd1, d1jyvd2, d1jyvd4, d1jyvd5 complexed with 145, dms, mg, na |
PDB Entry: 1jyv (more details), 1.75 Å
SCOPe Domain Sequences for d1jyvc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyvc3 b.18.1.5 (C:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d1jyvc3:
View in 3D Domains from same chain: (mouse over for more information) d1jyvc1, d1jyvc2, d1jyvc4, d1jyvc5 |