Lineage for d1jyvc1 (1jyv C:220-333)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) 
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) 
Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) Species Escherichia coli [TaxId:562] [49306] (46 PDB entries)
Uniprot P00722
Domain d1jyvc1: 1jyv C:220-333 [67500]
Other proteins in same PDB: d1jyva3, d1jyva4, d1jyva5, d1jyvb3, d1jyvb4, d1jyvb5, d1jyvc3, d1jyvc4, d1jyvc5, d1jyvd3, d1jyvd4, d1jyvd5
complexed with 145, dms, mg, na
Details for d1jyvc1
PDB Entry: 1jyv (more details), 1.75 Å
PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with onpg
PDB Compounds: (C:) beta-galactosidaseSCOPe Domain Sequences for d1jyvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyvc1 b.1.4.1 (C:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
SCOPe Domain Coordinates for d1jyvc1:
Click to download the PDB-style file with coordinates for d1jyvc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jyvc1:
- d1jyvc1 first appeared in SCOP 1.59
- d1jyvc1 appears in SCOPe 2.07
 View in 3DDomains from same chain: (mouse over for more information) d1jyvc2, d1jyvc3, d1jyvc4, d1jyvc5 |
