Lineage for d1jyvb3 (1jyv B:13-219)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163940Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 163941Superfamily b.18.1: Galactose-binding domain-like [49785] (15 families) (S)
  5. 163983Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)
  6. 163984Protein beta-Galactosidase [49804] (1 species)
  7. 163985Species Escherichia coli [TaxId:562] [49805] (23 PDB entries)
  8. 164015Domain d1jyvb3: 1jyv B:13-219 [67497]
    Other proteins in same PDB: d1jyva1, d1jyva2, d1jyva4, d1jyva5, d1jyvb1, d1jyvb2, d1jyvb4, d1jyvb5, d1jyvc1, d1jyvc2, d1jyvc4, d1jyvc5, d1jyvd1, d1jyvd2, d1jyvd4, d1jyvd5

Details for d1jyvb3

PDB Entry: 1jyv (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with onpg

SCOP Domain Sequences for d1jyvb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyvb3 b.18.1.5 (B:13-219) beta-Galactosidase {Escherichia coli}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOP Domain Coordinates for d1jyvb3:

Click to download the PDB-style file with coordinates for d1jyvb3.
(The format of our PDB-style files is described here.)

Timeline for d1jyvb3: