Lineage for d1jyva5 (1jyv A:334-625)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173428Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 173433Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 173434Species Escherichia coli [TaxId:562] [51511] (23 PDB entries)
  8. 173463Domain d1jyva5: 1jyv A:334-625 [67494]
    Other proteins in same PDB: d1jyva1, d1jyva2, d1jyva3, d1jyva4, d1jyvb1, d1jyvb2, d1jyvb3, d1jyvb4, d1jyvc1, d1jyvc2, d1jyvc3, d1jyvc4, d1jyvd1, d1jyvd2, d1jyvd3, d1jyvd4

Details for d1jyva5

PDB Entry: 1jyv (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with onpg

SCOP Domain Sequences for d1jyva5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyva5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilcqyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1jyva5:

Click to download the PDB-style file with coordinates for d1jyva5.
(The format of our PDB-style files is described here.)

Timeline for d1jyva5: