Lineage for d1jyva3 (1jyv A:13-219)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370246Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 370247Superfamily b.18.1: Galactose-binding domain-like [49785] (21 families) (S)
  5. 370292Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)
  6. 370293Protein beta-Galactosidase [49804] (1 species)
  7. 370294Species Escherichia coli [TaxId:562] [49805] (23 PDB entries)
  8. 370307Domain d1jyva3: 1jyv A:13-219 [67492]
    Other proteins in same PDB: d1jyva1, d1jyva2, d1jyva4, d1jyva5, d1jyvb1, d1jyvb2, d1jyvb4, d1jyvb5, d1jyvc1, d1jyvc2, d1jyvc4, d1jyvc5, d1jyvd1, d1jyvd2, d1jyvd4, d1jyvd5

Details for d1jyva3

PDB Entry: 1jyv (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with onpg

SCOP Domain Sequences for d1jyva3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyva3 b.18.1.5 (A:13-219) beta-Galactosidase {Escherichia coli}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOP Domain Coordinates for d1jyva3:

Click to download the PDB-style file with coordinates for d1jyva3.
(The format of our PDB-style files is described here.)

Timeline for d1jyva3: