Lineage for d1jyva1 (1jyv A:220-333)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 161124Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 161125Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 161126Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 161127Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)
  8. 161184Domain d1jyva1: 1jyv A:220-333 [67490]
    Other proteins in same PDB: d1jyva3, d1jyva4, d1jyva5, d1jyvb3, d1jyvb4, d1jyvb5, d1jyvc3, d1jyvc4, d1jyvc5, d1jyvd3, d1jyvd4, d1jyvd5

Details for d1jyva1

PDB Entry: 1jyv (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with onpg

SCOP Domain Sequences for d1jyva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyva1 b.1.4.1 (A:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOP Domain Coordinates for d1jyva1:

Click to download the PDB-style file with coordinates for d1jyva1.
(The format of our PDB-style files is described here.)

Timeline for d1jyva1: