Lineage for d1jync4 (1jyn C:731-1023)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227198Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 227254Superfamily b.30.5: Galactose mutarotase-like [74650] (5 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 227255Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 227256Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 227257Species Escherichia coli [TaxId:562] [49997] (23 PDB entries)
  8. 227280Domain d1jync4: 1jyn C:731-1023 [67476]
    Other proteins in same PDB: d1jyna1, d1jyna2, d1jyna3, d1jyna5, d1jynb1, d1jynb2, d1jynb3, d1jynb5, d1jync1, d1jync2, d1jync3, d1jync5, d1jynd1, d1jynd2, d1jynd3, d1jynd5

Details for d1jync4

PDB Entry: 1jyn (more details), 1.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with lactose
PDB Compounds: (C:)

SCOP Domain Sequences for d1jync4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jync4 b.30.5.1 (C:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1jync4:

Click to download the PDB-style file with coordinates for d1jync4.
(The format of our PDB-style files is described here.)

Timeline for d1jync4: