Lineage for d1jync3 (1jyn C:13-219)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1116326Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1116327Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1116431Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 1116432Protein beta-Galactosidase [49804] (2 species)
  7. 1116440Species Escherichia coli [TaxId:562] [49805] (25 PDB entries)
    Uniprot P00722
  8. 1116471Domain d1jync3: 1jyn C:13-219 [67475]
    Other proteins in same PDB: d1jyna1, d1jyna2, d1jyna4, d1jyna5, d1jynb1, d1jynb2, d1jynb4, d1jynb5, d1jync1, d1jync2, d1jync4, d1jync5, d1jynd1, d1jynd2, d1jynd4, d1jynd5
    complexed with dms, lat, mg, na

Details for d1jync3

PDB Entry: 1jyn (more details), 1.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with lactose
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1jync3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jync3 b.18.1.5 (C:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1jync3:

Click to download the PDB-style file with coordinates for d1jync3.
(The format of our PDB-style files is described here.)

Timeline for d1jync3: