Lineage for d1jyna5 (1jyn A:334-625)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116348Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 116528Family c.1.8.3: beta-glycanases [51487] (13 proteins)
  6. 116533Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 116534Species Escherichia coli [TaxId:562] [51511] (23 PDB entries)
  8. 116555Domain d1jyna5: 1jyn A:334-625 [67467]
    Other proteins in same PDB: d1jyna1, d1jyna2, d1jyna3, d1jyna4, d1jynb1, d1jynb2, d1jynb3, d1jynb4, d1jync1, d1jync2, d1jync3, d1jync4, d1jynd1, d1jynd2, d1jynd3, d1jynd4

Details for d1jyna5

PDB Entry: 1jyn (more details), 1.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with lactose

SCOP Domain Sequences for d1jyna5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyna5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilcqyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1jyna5:

Click to download the PDB-style file with coordinates for d1jyna5.
(The format of our PDB-style files is described here.)

Timeline for d1jyna5: