Lineage for d1jyld_ (1jyl D:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 126172Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
  4. 126173Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (11 families) (S)
  5. 126331Family c.68.1.13: Cytidylytransferase [68901] (3 proteins)
  6. 126355Protein CTP:phosphocholine cytidylytransferase LicC [69569] (1 species)
  7. 126356Species Streptococcus pneumoniae [TaxId:1313] [69570] (2 PDB entries)
  8. 126361Domain d1jyld_: 1jyl D: [67462]

Details for d1jyld_

PDB Entry: 1jyl (more details), 2.4 Å

PDB Description: Catalytic Mechanism of CTP:phosphocholine Cytidylytransferase from Streptococcus pneumoniae (LicC)

SCOP Domain Sequences for d1jyld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyld_ c.68.1.13 (D:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae}
irvkaiilaaglgtrlrpltentpkalvqvnqkplieyqieflkekgindiiiivgylke
qfdylkekygvrlvfndkyadynnfyslylvkeelansyvidadnylfknmfrndltrst
yfsvyredctnewflvygddykvqdiivdskagrilsgvsfwdaptaekivsfidkayvs
gefvdlywdnmvkdnikeldvyveelegnsiyeidsvqdyrkleeilk

SCOP Domain Coordinates for d1jyld_:

Click to download the PDB-style file with coordinates for d1jyld_.
(The format of our PDB-style files is described here.)

Timeline for d1jyld_: