Lineage for d1jyea_ (1jye A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 845996Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 845997Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 845998Family c.93.1.1: L-arabinose binding protein-like [53823] (16 proteins)
  6. 846093Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)
  7. 846094Species Escherichia coli [TaxId:562] [53838] (11 PDB entries)
  8. 846095Domain d1jyea_: 1jye A: [67455]
    complexed with gol; mutant

Details for d1jyea_

PDB Entry: 1jye (more details), 1.7 Å

PDB Description: structure of a dimeric lac repressor with c-terminal deletion and k84l substitution
PDB Compounds: (A:) lactose operon repressor

SCOP Domain Sequences for d1jyea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}
lligvatsslalhapsqivaailsradqlgasvvvsmversgveacktavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttlap

SCOP Domain Coordinates for d1jyea_:

Click to download the PDB-style file with coordinates for d1jyea_.
(The format of our PDB-style files is described here.)

Timeline for d1jyea_: