SCOP 1.71: Domain d1jyaa_: 1jya A:

Lineage for d1jyaa_ (1jya A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.198: Secretion chaperone-like [69634] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.1: Type III secretory system chaperone [69635] (1 family)

5. Family d.198.1.1: Type III secretory system chaperone [69636] (7 proteins)
   the family sequences are very divergent

6. Protein YopE chaperone SycE [69637] (2 species)

7. Species Yersinia pestis [TaxId:632] [69638] (3 PDB entries)

8. Domain d1jyaa_: 1jya A: [67453]

Details for d1jyaa_

PDB Entry: 1jya, 1.74 Å

PDB Description: crystal structure of syce

SCOP Domain Sequences for d1jyaa_:

Sequence; same for both SEQRES and ATOM records:

>d1jyaa_ d.198.1.1 (A:) YopE chaperone SycE {Yersinia pestis}
ysfeqaitqlfqqlslsipdtiepvigvkvgefachitehpvgqilmftlpsldnndeke
tllshnifsqdilkpilswdevgghpvlwnrqplnsldnnslytqlemlvqgaerlq

Timeline for d1jyaa_:

• d1jyaa_ first appeared in SCOP 1.59
  
• d1jyaa_ appears in SCOP 1.69
  
• d1jyaa_ appears in SCOP 1.73
  
• d1jyaa_ appears in the current release, SCOPe 2.08