Lineage for d1jy8a_ (1jy8 A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies) 
Superfamily d.79.5: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69765] (1 family) 
Family d.79.5.1: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69766] (1 protein) Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (1 species) Species Escherichia coli [TaxId:562] [69768] (1 PDB entry) 
Domain d1jy8a_: 1jy8 A: [67452]
Details for d1jy8a_
PDB Entry: 1jy8 (more details), 2.5 Å
PDB Description: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (IspF)
SCOP Domain Sequences for d1jy8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jy8a_ d.79.5.1 (A:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli}
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmddvnvkattteklgftgrgegiaceavalli
SCOP Domain Coordinates for d1jy8a_:
Click to download the PDB-style file with coordinates for d1jy8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jy8a_:
- d1jy8a_ is new in SCOP 1.59
- d1jy8a_ appears in SCOP 1.61
- d1jy8a_ appears in the current release, SCOPe 2.08
View in 3D