Lineage for d1jy8a_ (1jy8 A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134814Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
  4. 134926Superfamily d.79.5: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69765] (1 family) (S)
  5. 134927Family d.79.5.1: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69766] (1 protein)
  6. 134928Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (1 species)
  7. 134929Species Escherichia coli [TaxId:562] [69768] (1 PDB entry)
  8. 134930Domain d1jy8a_: 1jy8 A: [67452]

Details for d1jy8a_

PDB Entry: 1jy8 (more details), 2.5 Å

PDB Description: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (IspF)

SCOP Domain Sequences for d1jy8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jy8a_ d.79.5.1 (A:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli}
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmddvnvkattteklgftgrgegiaceavalli

SCOP Domain Coordinates for d1jy8a_:

Click to download the PDB-style file with coordinates for d1jy8a_.
(The format of our PDB-style files is described here.)

Timeline for d1jy8a_: