Lineage for d1jy3q_ (1jy3 Q:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 344850Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 345233Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 345234Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two tripple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 345235Protein Fibrinogen alpha chain [88887] (4 species)
  7. 345239Species Cow (Bos taurus) [TaxId:9913] [88890] (2 PDB entries)
  8. 345243Domain d1jy3q_: 1jy3 Q: [67449]
    Other proteins in same PDB: d1jy3o_, d1jy3p_, d1jy3r_, d1jy3s_
    central region only (e5 fragment)

Details for d1jy3q_

PDB Entry: 1jy3 (more details), 1.6 Å

PDB Description: crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution

SCOP Domain Sequences for d1jy3q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jy3q_ h.1.8.1 (Q:) Fibrinogen alpha chain {Cow (Bos taurus)}
gwpfcsdedwntkcpsgcrmkglidevdqdftsrinklrdslfn

SCOP Domain Coordinates for d1jy3q_:

Click to download the PDB-style file with coordinates for d1jy3q_.
(The format of our PDB-style files is described here.)

Timeline for d1jy3q_: