Lineage for d1jy3n_ (1jy3 N:)

  1. Root: SCOP 1.63
  2. 271841Class h: Coiled coil proteins [57942] (6 folds)
  3. 271842Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 272214Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 272215Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)
  6. 272216Protein Fibrinogen coiled-coil and central regions [58012] (4 species)
    in the central region two tripple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  7. 272224Species Cow (Bos taurus) [TaxId:9913] [69977] (2 PDB entries)
  8. 272231Domain d1jy3n_: 1jy3 N: [67446]

Details for d1jy3n_

PDB Entry: 1jy3 (more details), 1.6 Å

PDB Description: crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution

SCOP Domain Sequences for d1jy3n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jy3n_ h.1.8.1 (N:) Fibrinogen coiled-coil and central regions {Cow (Bos taurus)}
gwpfcsdedwntkcpsgcrmkglidevdqdftsrinklrdslfn

SCOP Domain Coordinates for d1jy3n_:

Click to download the PDB-style file with coordinates for d1jy3n_.
(The format of our PDB-style files is described here.)

Timeline for d1jy3n_: