![]() | Class h: Coiled coil proteins [57942] (5 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (21 superfamilies) |
![]() | Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) ![]() |
![]() | Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein) |
![]() | Protein Fibrinogen coiled-coil and central regions [58012] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [69977] (2 PDB entries) |
![]() | Domain d1jy2s_: 1jy2 S: [67445] |
PDB Entry: 1jy2 (more details), 1.4 Å
SCOP Domain Sequences for d1jy2s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jy2s_ h.1.8.1 (S:) Fibrinogen coiled-coil and central regions {Cow (Bos taurus)} vatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegily
Timeline for d1jy2s_: