Lineage for d1jy2s_ (1jy2 S:)

  1. Root: SCOP 1.59
  2. 145365Class h: Coiled coil proteins [57942] (5 folds)
  3. 145366Fold h.1: Parallel coiled-coil [57943] (21 superfamilies)
  4. 145692Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 145693Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)
  6. 145694Protein Fibrinogen coiled-coil and central regions [58012] (3 species)
  7. 145702Species Cow (Bos taurus) [TaxId:9913] [69977] (2 PDB entries)
  8. 145708Domain d1jy2s_: 1jy2 S: [67445]

Details for d1jy2s_

PDB Entry: 1jy2 (more details), 1.4 Å

PDB Description: crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution

SCOP Domain Sequences for d1jy2s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jy2s_ h.1.8.1 (S:) Fibrinogen coiled-coil and central regions {Cow (Bos taurus)}
vatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegily

SCOP Domain Coordinates for d1jy2s_:

Click to download the PDB-style file with coordinates for d1jy2s_.
(The format of our PDB-style files is described here.)

Timeline for d1jy2s_: