Lineage for d1jy2q_ (1jy2 Q:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2644538Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 2644539Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 2644540Protein Fibrinogen alpha chain [88887] (4 species)
  7. 2644544Species Cow (Bos taurus) [TaxId:9913] [88890] (2 PDB entries)
  8. 2644546Domain d1jy2q_: 1jy2 Q: [67443]
    Other proteins in same PDB: d1jy2o_, d1jy2p_, d1jy2r_, d1jy2s_
    central region only (e5 fragment)

Details for d1jy2q_

PDB Entry: 1jy2 (more details), 1.4 Å

PDB Description: crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution
PDB Compounds: (Q:) fibrinogen alpha chain

SCOPe Domain Sequences for d1jy2q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jy2q_ h.1.8.1 (Q:) Fibrinogen alpha chain {Cow (Bos taurus) [TaxId: 9913]}
gwpfcsdedwntkcpsgcrmkglidevdqdftsrinklrdslf

SCOPe Domain Coordinates for d1jy2q_:

Click to download the PDB-style file with coordinates for d1jy2q_.
(The format of our PDB-style files is described here.)

Timeline for d1jy2q_: