![]() | Class h: Coiled coil proteins [57942] (6 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (26 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) ![]() |
![]() | Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two tripple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
![]() | Protein Fibrinogen alpha chain [88887] (4 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [88890] (2 PDB entries) |
![]() | Domain d1jy2q_: 1jy2 Q: [67443] Other proteins in same PDB: d1jy2o_, d1jy2p_, d1jy2r_, d1jy2s_ central region only (e5 fragment) |
PDB Entry: 1jy2 (more details), 1.4 Å
SCOP Domain Sequences for d1jy2q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jy2q_ h.1.8.1 (Q:) Fibrinogen alpha chain {Cow (Bos taurus)} gwpfcsdedwntkcpsgcrmkglidevdqdftsrinklrdslf
Timeline for d1jy2q_: