Lineage for d1jy1a1 (1jy1 A:149-350)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216700Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 2216701Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 2216726Family d.136.1.3: Tyrosyl-DNA phosphodiesterase TDP1 [69815] (2 proteins)
  6. 2216727Protein Tyrosyl-DNA phosphodiesterase TDP1 [69816] (2 species)
  7. 2216737Species Human (Homo sapiens) [TaxId:9606] [69817] (12 PDB entries)
  8. 2216738Domain d1jy1a1: 1jy1 A:149-350 [67438]
    Other proteins in same PDB: d1jy1a3

Details for d1jy1a1

PDB Entry: 1jy1 (more details), 1.69 Å

PDB Description: crystal structure of human tyrosyl-dna phosphodiesterase (tdp1)
PDB Compounds: (A:) tyrosyl-DNA phosphodiesterase

SCOPe Domain Sequences for d1jy1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jy1a1 d.136.1.3 (A:149-350) Tyrosyl-DNA phosphodiesterase TDP1 {Human (Homo sapiens) [TaxId: 9606]}
gegqdiwdmldkgnpfqfyltrvsgvkpkynsgalhikdilsplfgtlvssaqfnycfdv
dwlvkqyppefrkkpillvhgdkreakahlhaqakpyenislcqakldiafgthhtkmml
llyeeglrvvihtsnlihadwhqktqgiwlsplypriadgthksgespthfkanlisylt
aynapslkewidvihkhdlset

SCOPe Domain Coordinates for d1jy1a1:

Click to download the PDB-style file with coordinates for d1jy1a1.
(The format of our PDB-style files is described here.)

Timeline for d1jy1a1: