Lineage for d1jxqa1 (1jxq A:139-402)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2100990Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2100991Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2100992Family c.17.1.1: Caspase catalytic domain [52130] (8 protein domains)
  6. 2101089Protein Caspase-9 [69443] (1 species)
  7. 2101090Species Human (Homo sapiens) [TaxId:9606] [69444] (2 PDB entries)
  8. 2101092Domain d1jxqa1: 1jxq A:139-402 [67426]
    Other proteins in same PDB: d1jxqa2, d1jxqb2, d1jxqc2, d1jxqd2

Details for d1jxqa1

PDB Entry: 1jxq (more details), 2.8 Å

PDB Description: Structure of cleaved, CARD domain deleted Caspase-9
PDB Compounds: (A:) Caspase-9

SCOPe Domain Sequences for d1jxqa1:

Sequence, based on SEQRES records: (download)

>d1jxqa1 c.17.1.1 (A:139-402) Caspase-9 {Human (Homo sapiens) [TaxId: 9606]}
mgaleslrgnadlayilsmepcghcliinnvnfcresglrtrtgsnidceklrrrfsslh
fmvevkgdltakkmvlallelarqdhgaldccvvvilshgcqashlqfpgavygtdgcpv
svekivnifngtscpslggkpklffiqacggeqkdhgfevastspedespgsnpepdatp
fqeglrtfdqldaisslptpsdifvsystfpgfvswrdpksgswyvetlddifeqwahse
dlqslllrvanavsvkgiykqmpgcfnflrkklffkt

Sequence, based on observed residues (ATOM records): (download)

>d1jxqa1 c.17.1.1 (A:139-402) Caspase-9 {Human (Homo sapiens) [TaxId: 9606]}
mgaleslrgnadlayilsmepcghcliinnvnfcresglrtrtgsnidceklrrrfsslh
fmvevkgdltakkmvlallelarqdhgaldccvvvilshgcqashlqfpgavygtdgcpv
svekivnifngtscpslggkpklffiqacggeqkdhgfevlptpsdifvsystfpgfvsw
rdpksgswyvetlddifeqwahsedlqslllrvanavsvkgiykqmpgcfnflrkklffk
t

SCOPe Domain Coordinates for d1jxqa1:

Click to download the PDB-style file with coordinates for d1jxqa1.
(The format of our PDB-style files is described here.)

Timeline for d1jxqa1: