Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Guanylate kinase-like domain of Psd-95 [69476] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [69477] (3 PDB entries) |
Domain d1jxob2: 1jxo B:526-720 [67425] Other proteins in same PDB: d1jxoa1, d1jxob1 |
PDB Entry: 1jxo (more details), 2.3 Å
SCOPe Domain Sequences for d1jxob2:
Sequence, based on SEQRES records: (download)
>d1jxob2 c.37.1.1 (B:526-720) Guanylate kinase-like domain of Psd-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]} vtqmevhyarpiiilgptkdranddllsefpdkfgscvphttrpkreyeidgrdyhfvss rekmekdiqahkfieagqynshlygtsvqsvrevaeqgkhcildvsanavrrlqaahlhp iaifirprslenvleinkriteeqarkafdratkleqeftecfsaivegdsfeeiyhkvk rviedlsgpyiwvpa
>d1jxob2 c.37.1.1 (B:526-720) Guanylate kinase-like domain of Psd-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]} vtqmevhyarpiiilgptkdranddllsefpdkfgscvphttrdgrdyhfvssrekmekd iqahkfieagqshlygtsvqsvrevaeqgkhcildvsanavrrlqaahlhpiaifirprs lenvleinkriteeqarkafdratkleqeftecfsaivegdsfeeiyhkvkrviedlsgp yiwvpa
Timeline for d1jxob2: