![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) ![]() |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (12 proteins) |
![]() | Protein Guanylate kinase-like domain of Psd-95 [69476] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [69477] (3 PDB entries) |
![]() | Domain d1jxob2: 1jxo B:526-720 [67425] Other proteins in same PDB: d1jxoa1, d1jxob1 |
PDB Entry: 1jxo (more details), 2.3 Å
SCOP Domain Sequences for d1jxob2:
Sequence, based on SEQRES records: (download)
>d1jxob2 c.37.1.1 (B:526-720) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus)} vtqmevhyarpiiilgptkdranddllsefpdkfgscvphttrpkreyeidgrdyhfvss rekmekdiqahkfieagqynshlygtsvqsvrevaeqgkhcildvsanavrrlqaahlhp iaifirprslenvleinkriteeqarkafdratkleqeftecfsaivegdsfeeiyhkvk rviedlsgpyiwvpa
>d1jxob2 c.37.1.1 (B:526-720) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus)} vtqmevhyarpiiilgptkdranddllsefpdkfgscvphttrdgrdyhfvssrekmekd iqahkfieagqshlygtsvqsvrevaeqgkhcildvsanavrrlqaahlhpiaifirprs lenvleinkriteeqarkafdratkleqeftecfsaivegdsfeeiyhkvkrviedlsgp yiwvpa
Timeline for d1jxob2: