SCOP 1.73: Domain d1jxob1: 1jxo B:430-525

Lineage for d1jxob1 (1jxo B:430-525)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (38 proteins)

6. Protein Psd-95 [69248] (1 species)
   associates with a guanylate kinase domain

7. Species Rat (Rattus norvegicus) [TaxId:10116] [69249] (3 PDB entries)

8. Domain d1jxob1: 1jxo B:430-525 [67424]
   Other proteins in same PDB: d1jxoa2, d1jxob2

Details for d1jxob1

PDB Entry: 1jxo, 2.3 Å

PDB Description: crystal structure of the sh3-hook-gk fragment of psd-95

PDB Compounds: (B:) postsynaptic density protein

SCOP Domain Sequences for d1jxob1:

Sequence, based on SEQRES records:

>d1jxob1 b.34.2.1 (B:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]}
gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetddigfip
skrrverrewsrlkakdwgsssgsqgredsvlsyet

Sequence, based on observed residues (ATOM records):

>d1jxob1 b.34.2.1 (B:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]}
gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhigfipskrrver
rewsrlkakdwgvlsyet

Timeline for d1jxob1:

• d1jxob1 first appeared in SCOP 1.59
  
• d1jxob1 appears in SCOP 1.71
  
• d1jxob1 appears in SCOP 1.75
  
• d1jxob1 appears in the current release, SCOPe 2.08