Class b: All beta proteins [48724] (165 folds) |
Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (38 proteins) |
Protein Psd-95 [69248] (1 species) associates with a guanylate kinase domain |
Species Rat (Rattus norvegicus) [TaxId:10116] [69249] (3 PDB entries) |
Domain d1jxob1: 1jxo B:430-525 [67424] Other proteins in same PDB: d1jxoa2, d1jxob2 |
PDB Entry: 1jxo (more details), 2.3 Å
SCOP Domain Sequences for d1jxob1:
Sequence, based on SEQRES records: (download)
>d1jxob1 b.34.2.1 (B:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetddigfip skrrverrewsrlkakdwgsssgsqgredsvlsyet
>d1jxob1 b.34.2.1 (B:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhigfipskrrver rewsrlkakdwgvlsyet
Timeline for d1jxob1: