SCOPe 2.06: Domain d1jxoa2: 1jxo A:526-720

Lineage for d1jxoa2 (1jxo A:526-720)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase-like domain of Psd-95 [69476] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [69477] (3 PDB entries)

8. Domain d1jxoa2: 1jxo A:526-720 [67423]
   Other proteins in same PDB: d1jxoa1, d1jxob1

Details for d1jxoa2

PDB Entry: 1jxo, 2.3 Å

PDB Description: crystal structure of the sh3-hook-gk fragment of psd-95

PDB Compounds: (A:) postsynaptic density protein

SCOPe Domain Sequences for d1jxoa2:

Sequence, based on SEQRES records:

>d1jxoa2 c.37.1.1 (A:526-720) Guanylate kinase-like domain of Psd-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vtqmevhyarpiiilgptkdranddllsefpdkfgscvphttrpkreyeidgrdyhfvss
rekmekdiqahkfieagqynshlygtsvqsvrevaeqgkhcildvsanavrrlqaahlhp
iaifirprslenvleinkriteeqarkafdratkleqeftecfsaivegdsfeeiyhkvk
rviedlsgpyiwvpa

Sequence, based on observed residues (ATOM records):

>d1jxoa2 c.37.1.1 (A:526-720) Guanylate kinase-like domain of Psd-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vtqmevhyarpiiilgptkdranddllsefpdkfgscvphttrrdyhfvssrekmekdiq
ahkfieagqshlygtsvqsvrevaeqgkhcildvsanavrrlqaahlhpiaifirprsle
nvleinkriteeqarkafdratkleqeftecfsaivegdsfeeiyhkvkrviedlsgpyi
wvpa

Timeline for d1jxoa2:

• d1jxoa2 first appeared in SCOP 1.59
  
• d1jxoa2 appears in SCOPe 2.05
  
• d1jxoa2 appears in SCOPe 2.07
  
• d1jxoa2 appears in the current release, SCOPe 2.08