Lineage for d1jxoa2 (1jxo A:526-720)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123294Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2123627Protein Guanylate kinase-like domain of Psd-95 [69476] (1 species)
  7. 2123628Species Norway rat (Rattus norvegicus) [TaxId:10116] [69477] (3 PDB entries)
  8. 2123631Domain d1jxoa2: 1jxo A:526-720 [67423]
    Other proteins in same PDB: d1jxoa1, d1jxob1

Details for d1jxoa2

PDB Entry: 1jxo (more details), 2.3 Å

PDB Description: crystal structure of the sh3-hook-gk fragment of psd-95
PDB Compounds: (A:) postsynaptic density protein

SCOPe Domain Sequences for d1jxoa2:

Sequence, based on SEQRES records: (download)

>d1jxoa2 c.37.1.1 (A:526-720) Guanylate kinase-like domain of Psd-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vtqmevhyarpiiilgptkdranddllsefpdkfgscvphttrpkreyeidgrdyhfvss
rekmekdiqahkfieagqynshlygtsvqsvrevaeqgkhcildvsanavrrlqaahlhp
iaifirprslenvleinkriteeqarkafdratkleqeftecfsaivegdsfeeiyhkvk
rviedlsgpyiwvpa

Sequence, based on observed residues (ATOM records): (download)

>d1jxoa2 c.37.1.1 (A:526-720) Guanylate kinase-like domain of Psd-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vtqmevhyarpiiilgptkdranddllsefpdkfgscvphttrrdyhfvssrekmekdiq
ahkfieagqshlygtsvqsvrevaeqgkhcildvsanavrrlqaahlhpiaifirprsle
nvleinkriteeqarkafdratkleqeftecfsaivegdsfeeiyhkvkrviedlsgpyi
wvpa

SCOPe Domain Coordinates for d1jxoa2:

Click to download the PDB-style file with coordinates for d1jxoa2.
(The format of our PDB-style files is described here.)

Timeline for d1jxoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jxoa1