Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (12 proteins) |
Protein Guanylate kinase-like domain of Psd-95 [69476] (1 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [69477] (3 PDB entries) |
Domain d1jxoa2: 1jxo A:526-720 [67423] Other proteins in same PDB: d1jxoa1, d1jxob1 |
PDB Entry: 1jxo (more details), 2.3 Å
SCOP Domain Sequences for d1jxoa2:
Sequence, based on SEQRES records: (download)
>d1jxoa2 c.37.1.1 (A:526-720) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus)} vtqmevhyarpiiilgptkdranddllsefpdkfgscvphttrpkreyeidgrdyhfvss rekmekdiqahkfieagqynshlygtsvqsvrevaeqgkhcildvsanavrrlqaahlhp iaifirprslenvleinkriteeqarkafdratkleqeftecfsaivegdsfeeiyhkvk rviedlsgpyiwvpa
>d1jxoa2 c.37.1.1 (A:526-720) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus)} vtqmevhyarpiiilgptkdranddllsefpdkfgscvphttrrdyhfvssrekmekdiq ahkfieagqshlygtsvqsvrevaeqgkhcildvsanavrrlqaahlhpiaifirprsle nvleinkriteeqarkafdratkleqeftecfsaivegdsfeeiyhkvkrviedlsgpyi wvpa
Timeline for d1jxoa2: