SCOP 1.59: Domain d1jxoa1: 1jxo A:430-525

Lineage for d1jxoa1 (1jxo A:430-525)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.34: SH3-like barrel [50036] (9 superfamilies)

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (20 proteins)

6. Protein Psd-95 [69248] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [69249] (3 PDB entries)

8. Domain d1jxoa1: 1jxo A:430-525 [67422]
   Other proteins in same PDB: d1jxoa2, d1jxob2

Details for d1jxoa1

PDB Entry: 1jxo, 2.3 Å

PDB Description: crystal structure of the sh3-hook-gk fragment of psd-95

SCOP Domain Sequences for d1jxoa1:

Sequence, based on SEQRES records:

>d1jxoa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus)}
gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetddigfip
skrrverrewsrlkakdwgsssgsqgredsvlsyet

Sequence, based on observed residues (ATOM records):

>d1jxoa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus)}
gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvigfipskrrverr
ewsrlkakdwgvlsyet

Timeline for d1jxoa1:

• d1jxoa1 is new in SCOP 1.59
  
• d1jxoa1 appears in SCOP 1.61
  
• d1jxoa1 appears in the current release, SCOPe 2.08