Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.2: Thiamin biosynthesis kinases [53620] (2 proteins) |
Protein 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) [69589] (2 species) |
Species Salmonella typhimurium [TaxId:90371] [69590] (2 PDB entries) |
Domain d1jxib_: 1jxi B: [67418] complexed with hmh, so4 |
PDB Entry: 1jxi (more details), 2.64 Å
SCOPe Domain Sequences for d1jxib_:
Sequence, based on SEQRES records: (download)
>d1jxib_ c.72.1.2 (B:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Salmonella typhimurium [TaxId: 90371]} mqrinaltiagtdpsggagiqadlktfsalgaygcsvitalvaentcgvqsvyriepdfv aaqldsvfsdvridttkigmlaetdiveavaerlqrhhvrnvvldtvmlaksgdpllsps aietlrvrllpqvslitpnlpeaaalldapharteqemlaqgrallamgceavlmkgghl edaqspdwlftregeqrfsaprvntknthgtgctlsaalaalrprhrswgetvneakawl saalaqadtlevgkgigpvhhfhaww
>d1jxib_ c.72.1.2 (B:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Salmonella typhimurium [TaxId: 90371]} mqrinaltiagtdpsggagiqadlktfsalgaygcsvitalvaentcgvqsvyriepdfv aaqldsvfsdvridttkigmlaetdiveavaerlqrhhvrnvvldtvmlaksgdpllsps aietlrvrllpqvslitpnlpeaaalldapharteqemlaqgrallamgceavlmkgdwl ftregeqrfrvntknthgtgctlsaalaalrprhrswgetvneakawlsaalaqadtlev gkgigpvhhfhaww
Timeline for d1jxib_: