Lineage for d1jxhb_ (1jxh B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137573Family c.72.1.2: Thiamin biosynthesis kinases [53620] (2 protein domains)
  6. 2137574Protein 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) [69589] (2 species)
  7. 2137575Species Salmonella typhimurium [TaxId:90371] [69590] (2 PDB entries)
  8. 2137577Domain d1jxhb_: 1jxh B: [67416]
    complexed with so4

Details for d1jxhb_

PDB Entry: 1jxh (more details), 2.3 Å

PDB Description: 4-Amino-5-hydroxymethyl-2-methylpyrimidine Phosphate Kinase from Salmonella typhimurium
PDB Compounds: (B:) phosphomethylpyrimidine kinase

SCOPe Domain Sequences for d1jxhb_:

Sequence, based on SEQRES records: (download)

>d1jxhb_ c.72.1.2 (B:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Salmonella typhimurium [TaxId: 90371]}
mqrinaltiagtdpsggagiqadlktfsalgaygcsvitalvaentcgvqsvyriepdfv
aaqldsvfsdvridttkigmlaetdiveavaerlqrhhvrnvvldtvmlaksgdpllsps
aietlrvrllpqvslitpnlpeaaalldapharteqemlaqgrallamgceavlmkgghl
edaqspdwlftregeqrfsaprvntknthgtgctlsaalaalrprhrswgetvneakawl
saalaqadtlevgkgigpvhhfhaww

Sequence, based on observed residues (ATOM records): (download)

>d1jxhb_ c.72.1.2 (B:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Salmonella typhimurium [TaxId: 90371]}
mqrinaltiagtdpsggagiqadlktfsalgaygcsvitalvaentcgvqsvyriepdfv
aaqldsvfsdvridttkigmlaetdiveavaerlqrhhvrnvvldtvmlllspsaietlr
vrllpqvslitpnlpeaaalldapharteqemlaqgrallamgceavlmkgdwlftrege
qrfrvntknthgtgctlsaalaalrprhrswgetvneakawlsaalaqadtlevgkgigp
vhhfhaww

SCOPe Domain Coordinates for d1jxhb_:

Click to download the PDB-style file with coordinates for d1jxhb_.
(The format of our PDB-style files is described here.)

Timeline for d1jxhb_: